DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and hoxb4a

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_571193.1 Gene:hoxb4a / 30340 ZFINID:ZDB-GENE-990415-105 Length:246 Species:Danio rerio


Alignment Length:234 Identity:78/234 - (33%)
Similarity:102/234 - (43%) Gaps:53/234 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 ASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFA 314
            |.||:.|.::.:.|                .|...|:.|.|.|..:....|.| :.....|.|..
Zfish     2 AMSSYLINSNYVDP----------------KFPPCEEYSQSDYLPSHSPDYYS-AQRQDPSFQHE 49

  Fly   315 QFYQHATAAA-------------SAVSAASAGAIGVDSLGNACTQPA---SGVMPGAGGAGG--- 360
            ..|...:..|             :||.:.....:...:|.....:|:   ..|.|....|.|   
Zfish    50 SIYHQRSGCADPPYSSCQGPGQPAAVISPRGHVLPTTALSTPLPEPSHHCDSVTPSPPPACGQTP 114

  Fly   361 --------AGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEF 417
                    :...|...||||.      .....:|..:::|  |.| :|.|..|||.|.|||||||
Zfish   115 TSQNTSTVSSRKDPVVYPWMK------KVHVNIVSPNYSG--GEP-KRSRTAYTRQQVLELEKEF 170

  Fly   418 HFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKE 456
            |:|.|||||||:||||.|||:||||||||||||||.||:
Zfish   171 HYNRYLTRRRRVEIAHTLCLSERQIKIWFQNRRMKWKKD 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 42/51 (82%)
Abdominal-A 456..478 CDD:289192 0/1 (0%)
hoxb4aNP_571193.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 23..125 17/102 (17%)
Antp-type hexapeptide 130..135 3/4 (75%)
Homeobox 154..207 CDD:278475 42/52 (81%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 210..246 78/234 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.