| Sequence 1: | NP_732176.1 | Gene: | abd-A / 42037 | FlyBaseID: | FBgn0000014 | Length: | 590 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_571192.2 | Gene: | hoxb3a / 30339 | ZFINID: | ZDB-GENE-990415-104 | Length: | 417 | Species: | Danio rerio |
| Alignment Length: | 233 | Identity: | 71/233 - (30%) |
|---|---|---|---|
| Similarity: | 94/233 - (40%) | Gaps: | 80/233 - (34%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 299 SYQSMS-----VPASA---SAQFAQFYQHATAAASAVSAASAGAIGVDS-----------LGNAC 344
Fly 345 TQP----------------------ASGVMPGAGGAGGAGIA-------------DLPRYPWMT- 373
Fly 374 -LTDWM-----------GSPFERVVCGDFNG-----PNGCPRRRGRQTYTRFQTLELEKEFHFNH 421
Fly 422 YLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRA 459 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| abd-A | NP_732176.1 | Homeobox | 402..454 | CDD:278475 | 36/51 (71%) |
| Abdominal-A | 456..478 | CDD:289192 | 0/4 (0%) | ||
| hoxb3a | NP_571192.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 51..135 | 11/83 (13%) | |
| Antp-type hexapeptide | 140..145 | 1/4 (25%) | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 147..184 | 5/36 (14%) | |||
| Homeobox | 184..236 | CDD:278475 | 36/51 (71%) | ||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 237..290 | 1/5 (20%) | |||
| DUF4074 | 353..415 | CDD:290032 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 381..417 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 3 | 2.810 | |||||