DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and hoxd4a

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001119917.1 Gene:hoxd4a / 30329 ZFINID:ZDB-GENE-980526-214 Length:256 Species:Danio rerio


Alignment Length:247 Identity:81/247 - (32%)
Similarity:101/247 - (40%) Gaps:67/247 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   289 CSRYTDTVMNSYQSMSVPASASA------QFAQFYQHATAAASAVSAASAGAIGVDSLGN----- 342
            |..|:   .|||.....|...|.      |....|..:..:....|.::.....|...|:     
Zfish    40 CEEYS---QNSYIPEQSPGYYSPSQDTDFQHPGIYSRSNYSEQPYSCSTVQGSSVQPRGHVQDQA 101

  Fly   343 -------ACTQPASGVMPGAGGAGGA--------GI-ADLPR--YPWMTLTDWMGSPFERV---- 385
                   |.|:....|.......||.        || ...|.  ||||          ::|    
Zfish   102 STPSPFPAQTEQCPAVQISGSRTGGQQQNTKTQNGIPTKQPAVVYPWM----------KKVHVTT 156

  Fly   386 VCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRR 450
            |..|:.||.   .:|.|..|||.|.||||||||||.||||||||||||.|||:||||||||||||
Zfish   157 VNPDYTGPE---PKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRR 218

  Fly   451 MKLKKELRAVKEINEQARRDREEQEKMKAQETMKSAQQNKQVQQQQQQQQQQ 502
            ||.||:                  .|:...:...::..|:..|..|:..|.:
Zfish   219 MKWKKD------------------HKLPNTKGRSASVGNQHAQHAQKDSQTE 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 44/51 (86%)
Abdominal-A 456..478 CDD:289192 1/21 (5%)
hoxd4aNP_001119917.1 Homeobox 169..222 CDD:278475 44/52 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.