DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxa9

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_003752231.1 Gene:Hoxa9 / 297099 RGDID:1310001 Length:271 Species:Rattus norvegicus


Alignment Length:298 Identity:87/298 - (29%)
Similarity:113/298 - (37%) Gaps:76/298 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   190 PPSAGNSQAGDSSCSPSPSASGSSSLHRSLNDNSPGSASASASASAAS--SVAAAAAAAAAAASS 252
            |.:.|..|...::.:..|             |.||.|..:.|:...||  .|.||.|.|..|   
  Rat    32 PGALGQPQRQAAALAEHP-------------DFSPCSFQSKAAVFGASWNPVHAAGANAVPA--- 80

  Fly   253 SFAIPTSKMYPYVSNHPSSHGGLS---------------GMAGFTGLEDKSCSRYTDTVMNSYQS 302
              |:.....:|||  ||.:....:               |...|.||...          ..|..
  Rat    81 --AVYHHHHHPYV--HPQAPVAAAAPDGRYMRSWLEPTPGALSFAGLPSS----------RPYGI 131

  Fly   303 MSVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLP 367
            ...|.||...........|.   :::..:.|:..||..    .||:.|..........:|....|
  Rat   132 KPEPLSARRGDCPTLDTHTL---SLTDYACGSPPVDRE----KQPSEGAFSENNAENESGGDKPP 189

  Fly   368 RYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIA 432
            ..|.....:|:.:...|        ...||       ||:.|||||||||.||.||||.||.|:|
  Rat   190 IDPNNPAANWLHARSTR--------KKRCP-------YTKHQTLELEKEFLFNMYLTRDRRYEVA 239

  Fly   433 HALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRD 470
            ..|.|||||:||||||||||:||       ||:...:|
  Rat   240 RLLNLTERQVKIWFQNRRMKMKK-------INKDRAKD 270

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 37/51 (73%)
Abdominal-A 456..478 CDD:289192 3/15 (20%)
Hoxa9XP_003752231.1 Hox9_act 1..192 CDD:398350 40/196 (20%)
Homeobox 208..262 CDD:395001 39/60 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.