DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Pdx1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_074043.4 Gene:Pdx1 / 29535 RGDID:62387 Length:283 Species:Rattus norvegicus


Alignment Length:127 Identity:57/127 - (44%)
Similarity:64/127 - (50%) Gaps:22/127 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   340 LGNACTQPASGVMPGAGGAGG---AGIADLPRYPWMTLT-------DWMGSPFERVVCGDFNGPN 394
            ||.|  .|..|..|.....||   .....|| :|||..|       .|.|..:..       .|.
  Rat    90 LGLA--HPPPGPFPNGTETGGLEEPSRVHLP-FPWMKSTKAHAWKSQWAGGAYAA-------EPE 144

  Fly   395 GCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKE 456
              ..:|.|..|||.|.|||||||.||.|::|.||:|:|..|.||||.|||||||||||.|||
  Rat   145 --ENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 36/51 (71%)
Abdominal-A 456..478 CDD:289192 1/1 (100%)
Pdx1NP_074043.4 Transactivation domain 13..73
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..81
Antp-type hexapeptide 118..123 3/5 (60%)
Homeobox 149..203 CDD:395001 36/53 (68%)
Nuclear localization signal. /evidence=ECO:0000250 197..203 4/5 (80%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..283 3/4 (75%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.