DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Meox2

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_058845.2 Gene:Meox2 / 29279 RGDID:3079 Length:303 Species:Rattus norvegicus


Alignment Length:464 Identity:108/464 - (23%)
Similarity:145/464 - (31%) Gaps:189/464 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 SPSSSSN-----NNSNLNLSGGSLSPSHLSQHLGQSPHSPVSSSSPF------------QQHHPQ 127
            ||.:::.     :.|:|.|.|.|   .|:|.     |....||||..            .|||  
  Rat    11 SPHATAQGLHPFSQSSLALHGRS---DHMSY-----PELSTSSSSCIIAGYPNEEGMFASQHH-- 65

  Fly   128 VQQQHLNHQQQQHLHHQQQQHHHQYSSLSAALQLQQQQHHISKLAAAAVASHGHAHQQLLLTPPS 192
              :.|.:|....|.|||||||           |..|...|:.::::...|    |...|.|.|.|
  Rat    66 --RGHHHHHHHHHHHHQQQQH-----------QALQSNWHLPQMSSPPSA----ARHSLCLQPDS 113

  Fly   193 AGNSQAGDSSCSPSPSASGSSSLHRSLNDNSPGSASASASASAASSVAAAAAAAAAAASSSFAIP 257
            .|..:.|.   ||....|.||||         ||::.:.:|.|.......|.:.|.....|    
  Rat   114 GGPPELGS---SPPVLCSNSSSL---------GSSTPTGAACAPGDYGRQALSPAEVEKRS---- 162

  Fly   258 TSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATA 322
                                     |.:.||.|  :|:...:|:|                    
  Rat   163 -------------------------GSKRKSDS--SDSQEGNYKS-------------------- 180

  Fly   323 AASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVC 387
                                                                             
  Rat   181 ----------------------------------------------------------------- 180

  Fly   388 GDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMK 452
                ..|..||:. |..:|:.|..|||.||..::||||.||.|||..|.|||||:|:||||||||
  Rat   181 ----EVNSKPRKE-RTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQVKVWFQNRRMK 240

  Fly   453 LKKELRAVKEINEQARRDREEQEKMKAQETMKSAQQNKQVQQQQQQQQQQQQQQQQQHQQQQQQP 517
            .|:    ||...:.|....:|...:|....:.|..........||..........:.        
  Rat   241 WKR----VKGGQQGAAAREKELVNVKKGTLLPSELSGIGAATLQQTGDSLANDDSRD-------- 293

  Fly   518 QDHHSIIAH 526
            .||.|..||
  Rat   294 SDHSSEHAH 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 32/51 (63%)
Abdominal-A 456..478 CDD:289192 4/21 (19%)
Meox2NP_058845.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..191 48/279 (17%)
Homeobox 190..243 CDD:395001 32/52 (62%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 279..303 7/32 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.