DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxd4

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001099355.1 Gene:Hoxd4 / 288153 RGDID:1309690 Length:251 Species:Rattus norvegicus


Alignment Length:118 Identity:64/118 - (54%)
Similarity:70/118 - (59%) Gaps:20/118 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   343 ACTQPASGVMPGAGGAGGAGIADLPR--YPWMTLTDWMGSPFERVVCGDFNGPN--GCPRRRGRQ 403
            ||:||.....|..|.|     ...|.  ||||          ::|.....| ||  |...:|.|.
  Rat   109 ACSQPTGPKQPPPGTA-----LKQPAVVYPWM----------KKVHVNSVN-PNYTGGEPKRSRT 157

  Fly   404 TYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKE 456
            .|||.|.||||||||||.||||||||||||.|||:||||||||||||||.||:
  Rat   158 AYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQIKIWFQNRRMKWKKD 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 44/51 (86%)
Abdominal-A 456..478 CDD:289192 0/1 (0%)
Hoxd4NP_001099355.1 Homeobox 155..209 CDD:395001 44/53 (83%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.