DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxd3

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001257967.1 Gene:Hoxd3 / 288152 RGDID:1588601 Length:432 Species:Rattus norvegicus


Alignment Length:253 Identity:73/253 - (28%)
Similarity:109/253 - (43%) Gaps:65/253 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 GLSGMAGFTGLEDKSCSRYTDTVMNS--YQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIG 336
            ||.|..|:        |:.||....|  :|....||:|::..:.:...|.:..|:....:....|
  Rat    27 GLFGGYGY--------SKATDAYGYSTPHQPYPPPAAANSLDSDYPSSACSIQSSAPLRAPAHKG 83

  Fly   337 VDSLGNACTQPASGVMPGAGGAG-----------------------------GAGI--------- 363
            .: |..:|.:|.:|...|.||..                             |:|:         
  Rat    84 AE-LNGSCMRPGTGNSQGGGGGNQPPGLNSEQQPPQPPPPPPTLPPSSPTNPGSGVPAKKTKGGP 147

  Fly   364 ------ADLPR--YPWMTLTDWMGSPFERVVCG------DFNGPNGCPRRRGRQTYTRFQTLELE 414
                  :.:.:  :|||  .:...:..::..|.      :...|.|...:|.|..||..|.:|||
  Rat   148 NASSSSSTISKQIFPWM--KESRQNSKQKNSCATSGENCEDKSPPGPASKRVRTAYTSAQLVELE 210

  Fly   415 KEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDRE 472
            ||||||.||.|.||:|:|:.|.||||||||||||||||.||:.:|...::..|.:..|
  Rat   211 KEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKAKGILHSPAGQSPE 268

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 37/51 (73%)
Abdominal-A 456..478 CDD:289192 3/17 (18%)
Hoxd3NP_001257967.1 Homeobox 198..251 CDD:395001 37/52 (71%)
DUF4074 369..430 CDD:404218
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.