Sequence 1: | NP_732176.1 | Gene: | abd-A / 42037 | FlyBaseID: | FBgn0000014 | Length: | 590 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001257967.1 | Gene: | Hoxd3 / 288152 | RGDID: | 1588601 | Length: | 432 | Species: | Rattus norvegicus |
Alignment Length: | 253 | Identity: | 73/253 - (28%) |
---|---|---|---|
Similarity: | 109/253 - (43%) | Gaps: | 65/253 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 274 GLSGMAGFTGLEDKSCSRYTDTVMNS--YQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIG 336
Fly 337 VDSLGNACTQPASGVMPGAGGAG-----------------------------GAGI--------- 363
Fly 364 ------ADLPR--YPWMTLTDWMGSPFERVVCG------DFNGPNGCPRRRGRQTYTRFQTLELE 414
Fly 415 KEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDRE 472 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
abd-A | NP_732176.1 | Homeobox | 402..454 | CDD:278475 | 37/51 (73%) |
Abdominal-A | 456..478 | CDD:289192 | 3/17 (18%) | ||
Hoxd3 | NP_001257967.1 | Homeobox | 198..251 | CDD:395001 | 37/52 (71%) |
DUF4074 | 369..430 | CDD:404218 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000007 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.810 |