DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxb9

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001093967.1 Gene:Hoxb9 / 287647 RGDID:1306158 Length:250 Species:Rattus norvegicus


Alignment Length:282 Identity:82/282 - (29%)
Similarity:106/282 - (37%) Gaps:85/282 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   180 GHAHQQLLLTPPSAG---NSQAGDSSCSP-SPSASGS--SSLHRSLNDNSPGSASASASASAASS 238
            |||..   |..||..   .:....:|.:| ||.||||  |..|..|   .|..|.|:.|....:.
  Rat    40 GHAEH---LDFPSCSFQPKAPVFGASWAPLSPHASGSLPSVYHPYL---QPQGAPAAESRYLRTW 98

  Fly   239 VAAAAAAAAAAASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSM 303
            :..|..|.||......|:   |..|           |.|..|             :.:.......
  Rat    99 LEPAPRAEAAPGQGQAAV---KAEP-----------LLGAPG-------------ELLKQGTPEY 136

  Fly   304 SVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPR 368
            |:..||..:.....|.|....:.:...|......|.     |.|::                   
  Rat   137 SLETSAGREAVLSNQRAGYGDNKICEGSEDKERPDQ-----TNPSA------------------- 177

  Fly   369 YPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAH 433
                   :|:.:...|        ...||       ||::|||||||||.||.||||.||.|:|.
  Rat   178 -------NWLHARSSR--------KKRCP-------YTKYQTLELEKEFLFNMYLTRDRRHEVAR 220

  Fly   434 ALCLTERQIKIWFQNRRMKLKK 455
            .|.|:|||:||||||||||:||
  Rat   221 LLNLSERQVKIWFQNRRMKMKK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 36/51 (71%)
Abdominal-A 456..478 CDD:289192 82/282 (29%)
Hoxb9NP_001093967.1 Hox9_act 1..172 CDD:398350 37/164 (23%)
Homeobox 188..242 CDD:395001 38/60 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.