DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and LHX6

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_011516823.1 Gene:LHX6 / 26468 HGNCID:21735 Length:407 Species:Homo sapiens


Alignment Length:279 Identity:52/279 - (18%)
Similarity:81/279 - (29%) Gaps:125/279 - (44%)


- Green bases have known domain annotations that are detailed below.


  Fly   301 QSMSVPASASAQFAQFYQHATAAASAVSAAS--AGAIGVD---------SLGNACTQP-ASGVMP 353
            |.|:.|.|......:..:.....|.|.|.|.  |||:..|         |..:.|:.| |:..:|
Human    28 QVMAQPGSGCKATTRCLEGTAPPAMAQSDAEALAGALDKDEGQASPCTPSTPSVCSPPSAASSVP 92

  Fly   354 GAGG--AGGAGIADLPRY-------PW-------------------------------------- 371
            .||.  ....|:..|.||       .|                                      
Human    93 SAGKNICSSCGLEILDRYLLKVNNLIWHVRCLECSVCRTSLRQQNSCYIKNKEIFCKMDYFSRFG 157

  Fly   372 ---------MTLTDWM------------------------GSPF----ERVVC------------ 387
                     :..:||:                        |..|    |:|:|            
Human   158 TKCARCGRQIYASDWVRRARGNAYHLACFACFSCKRQLSTGEEFGLVEEKVLCRIHYDTMIENLK 222

  Fly   388 -GDFNGPNGC---------------PRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALC 436
             ...|| ||.               |.:|.|.::|..|...::.:|..::....:...::|....
Human   223 RAAENG-NGLTLEGAVPSEQDSQPKPAKRARTSFTAEQLQVMQAQFAQDNNPDAQTLQKLADMTG 286

  Fly   437 LTERQIKIWFQNRRMKLKK 455
            |:.|.|::||||.|.:.||
Human   287 LSRRVIQVWFQNCRARHKK 305

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 13/51 (25%)
Abdominal-A 456..478 CDD:289192 52/279 (19%)
LHX6XP_011516823.1 LIM1_Lhx6 99..152 CDD:188766 5/52 (10%)
LIM2_Lhx6 160..214 CDD:188768 7/53 (13%)
Homeobox 252..304 CDD:278475 13/51 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.