DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and GBX1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001092304.1 Gene:GBX1 / 2636 HGNCID:4185 Length:363 Species:Homo sapiens


Alignment Length:338 Identity:94/338 - (27%)
Similarity:132/338 - (39%) Gaps:80/338 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   204 SPSPSASG-------SSSLHRSLNDNSPGSASASASASAASS-----------------VAAAAA 244
            :|:|..:|       :|...|..|....|...|..|..|.::                 :|||||
Human    62 APAPLPAGLPPLAPLASFAGRLTNTFCAGLGQAVPSMVALTTALPSFAEPPDAFYGPQELAAAAA 126

  Fly   245 AAAAAASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMS-VPAS 308
            ||||.|:              .|:|..    .|.....|||       .|.::.:.:.:: .|..
Human   127 AAAATAA--------------RNNPEP----GGRRPEGGLE-------ADELLPAREKVAEPPPP 166

  Fly   309 ASAQFAQFYQHATAAASAVSA------ASAGAIGVDSLGNACTQPAS-------GVMPGAGGAGG 360
            ....|::.:....|.....|:      ||||    |..|:...:..|       |.:..:.|..|
Human   167 PPPHFSETFPSLPAEGKVYSSDEEKLEASAG----DPAGSEQEEEGSGGDSEDDGFLDSSAGGPG 227

  Fly   361 AGIADLPRYPWMTLTDWMGSPFER--VVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYL 423
            |.:...|:     |...:|:..|.  .|......|.|..||| |..:|..|.||||||||...||
Human   228 ALLGPKPK-----LKGSLGTGAEEGAPVTAGVTAPGGKSRRR-RTAFTSEQLLELEKEFHCKKYL 286

  Fly   424 TRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEKMKAQETMKSAQQ 488
            :...|.:|||||.|:|.|:||||||||.|.|:    :|..|..: |..|.....|....:.....
Human   287 SLTERSQIAHALKLSEVQVKIWFQNRRAKWKR----IKAGNVSS-RSGEPVRNPKIVVPIPVHVN 346

  Fly   489 NKQVQQQQQQQQQ 501
            ...|:.|.||.:|
Human   347 RFAVRSQHQQMEQ 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 31/51 (61%)
Abdominal-A 456..478 CDD:289192 4/21 (19%)
GBX1NP_001092304.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..31
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 128..265 36/171 (21%)
Homeobox 264..317 CDD:306543 32/53 (60%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.