DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxc6

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_038936324.1 Gene:Hoxc6 / 252885 RGDID:620626 Length:243 Species:Rattus norvegicus


Alignment Length:128 Identity:68/128 - (53%)
Similarity:79/128 - (61%) Gaps:16/128 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly   364 ADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRR 428
            |.:..||||   ..|.|.....|.|......|..||||||.|:|:||||||||||||.|||||||
  Rat   118 ASIQIYPWM---QRMNSHSVCFVPGSLGVGYGADRRRGRQIYSRYQTLELEKEFHFNRYLTRRRR 179

  Fly   429 IEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEIN-------------EQARRDREEQEKMK 478
            ||||:|||||||||||||||||||.|||......::             ::.:|:..|:||.|
  Rat   180 IEIANALCLTERQIKIWFQNRRMKWKKESNLTSTLSGGGGGATADSLGGKEEKREETEEEKQK 242

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 46/51 (90%)
Abdominal-A 456..478 CDD:289192 5/34 (15%)
Hoxc6XP_038936324.1 Homeobox 153..206 CDD:395001 46/52 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.