DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Bsx

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_839976.1 Gene:Bsx / 244813 MGIID:2669849 Length:232 Species:Mus musculus


Alignment Length:121 Identity:42/121 - (34%)
Similarity:61/121 - (50%) Gaps:16/121 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   369 YPWMTLTDWMGSP--FERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEI 431
            :|:...|..|..|  |......:..|.: |.||:.|..::..|...|||.|....||:...|:|:
Mouse    80 HPYFLTTSGMPVPALFPHPQHAELPGKH-CRRRKARTVFSDSQLSGLEKRFEIQRYLSTPERVEL 143

  Fly   432 AHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEKMKAQETMKSAQ 487
            |.||.|:|.|:|.||||||||.||:|             |:.|::.||.:..:|.:
Mouse   144 ATALSLSETQVKTWFQNRRMKHKKQL-------------RKSQDEPKAADGPESPE 186

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 25/51 (49%)
Abdominal-A 456..478 CDD:289192 3/21 (14%)
BsxNP_839976.1 Homeobox 114..167 CDD:395001 25/52 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 160..232 13/40 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.