DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxc8

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001170797.2 Gene:Hoxc8 / 24460 RGDID:2821 Length:242 Species:Rattus norvegicus


Alignment Length:257 Identity:77/257 - (29%)
Similarity:122/257 - (47%) Gaps:71/257 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   262 YPYVSNHPSS--HGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAA 324
            :.:.|:|...  |.|.||::. :|.:...|            |:|....||    :||.:.....
  Rat    49 FQHASHHVQDFFHHGTSGISN-SGYQQNPC------------SLSCHGDAS----KFYGYEALPR 96

  Fly   325 SAVSAASAGAIGV---DSLGNACTQPASGVMPGAGGAGGAGIADLP--RYPWMTLTDWMGSPFER 384
            .::..|...|..|   |...:|.|..:.       |.|.......|  .:|||.           
  Rat    97 QSLYGAQQEASVVQYPDCKSSANTNSSE-------GQGHLNQNSSPSLMFPWMR----------- 143

  Fly   385 VVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNR 449
                    |:...||.|||||:|:|||||||||.||.||||:||||::|||.|||||:|||||||
  Rat   144 --------PHAPGRRSGRQTYSRYQTLELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNR 200

  Fly   450 RMKLKKELRAVKEINEQARRDREEQEKMKAQETMKSAQQNKQVQQQQQQQQQQQQQQQQQHQ 511
            |||.|||                     ..::.:..|:..::|:::..::::::::::::::
  Rat   201 RMKWKKE---------------------NNKDKLPGARDEEKVEEEGNEEEEKEEEEKEENK 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 42/51 (82%)
Abdominal-A 456..478 CDD:289192 1/21 (5%)
Hoxc8NP_001170797.2 Homeobox 153..206 CDD:395001 42/52 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.