DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxc4

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001103354.1 Gene:Hoxc4 / 24459 RGDID:1586210 Length:264 Species:Rattus norvegicus


Alignment Length:337 Identity:95/337 - (28%)
Similarity:119/337 - (35%) Gaps:134/337 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   181 HAHQQLLLTPPSAGNSQAGDSSCSPSPSASGSSSLHRSLNDNSPGSASASASASAASSVAAAAAA 245
            |.||:|...||...:......||:   |..|            ||::.|...|.|.         
  Rat    47 HHHQELYPPPPPRPSYPERQYSCT---SLQG------------PGNSRAHGPAQAG--------- 87

  Fly   246 AAAAASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASAS 310
                                .:||                :||            |.:..||..|
  Rat    88 --------------------HHHP----------------EKS------------QPLCEPAPLS 104

  Fly   311 AQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPR------- 368
            .          |:||...|..           ||:|||               .|.|.       
  Rat   105 G----------ASASPSPAPP-----------ACSQPA---------------PDHPSSAASKQP 133

  Fly   369 --YPWMTLTDWMGSPFERVVCGDFN-GPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIE 430
              ||||          :::.....| ..||...:|.|..|||.|.||||||||:|.|||||||||
  Rat   134 IVYPWM----------KKIHVSTVNPNYNGGEPKRSRTAYTRQQVLELEKEFHYNRYLTRRRRIE 188

  Fly   431 IAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEKMKAQETMKSAQQNKQVQQQ 495
            |||:|||:||||||||||||||.||:.|...      .:.|.......|..|:.:|.........
  Rat   189 IAHSLCLSERQIKIWFQNRRMKWKKDHRLPN------TKVRSAPPAGAAPSTLSAATPGTSEDHS 247

  Fly   496 QQQQQQQQQQQQ 507
            |.....:||:.:
  Rat   248 QSATPPEQQRAE 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 43/51 (84%)
Abdominal-A 456..478 CDD:289192 2/21 (10%)
Hoxc4NP_001103354.1 Homeobox 159..213 CDD:395001 43/53 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.