DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxb8

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001178578.1 Gene:Hoxb8 / 24457 RGDID:1586211 Length:243 Species:Rattus norvegicus


Alignment Length:402 Identity:105/402 - (26%)
Similarity:142/402 - (35%) Gaps:189/402 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly    94 SGGSLSPSH----LSQHLGQSP---HSPVSSSSPFQQHHPQVQQQHLNHQQQQHLHHQQQQHHHQ 151
            :|.||.|::    .:|.||..|   :.| ||...||  ||.                |.|:.:|.
  Rat    15 TGESLRPNYYDCGFAQDLGGRPTVVYGP-SSGGSFQ--HPS----------------QIQEFYHG 60

  Fly   152 YSSLSAALQLQQQQHHISKLAAAAVASHGHAHQQLLLTPPSAGNSQAGDSSCSPSPSASGSSSLH 216
            .||||.|   ..||:      ..|||.||                                    
  Rat    61 PSSLSTA---PYQQN------PCAVACHG------------------------------------ 80

  Fly   217 RSLNDNSPGSASASASASAASSVAAAAAAAAAAASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGF 281
                  .||:                                  .|.|   .|.....|      
  Rat    81 ------DPGN----------------------------------FYGY---DPLQRQSL------ 96

  Fly   282 TGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQ 346
            .|.:|....:|.|..:                                |:|..:|.::.|:..:.
  Rat    97 FGAQDPDLVQYADCKL--------------------------------AAASGLGEEAEGSEQSP 129

  Fly   347 PASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTL 411
            ..:.:                 :|||.         .:...|         ||||||||:|:|||
  Rat   130 SPTQL-----------------FPWMR---------PQAAAG---------RRRGRQTYSRYQTL 159

  Fly   412 ELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEK 476
            ||||||.||.||||:||||::|||.|||||:||||||||||.|||..  |:....::.::||.||
  Rat   160 ELEKEFLFNPYLTRKRRIEVSHALGLTERQVKIWFQNRRMKWKKENN--KDKFPSSKCEQEELEK 222

  Fly   477 MKAQETMKSAQQ 488
            .|.:...::|:|
  Rat   223 EKLERAPETAEQ 234

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 42/51 (82%)
Abdominal-A 456..478 CDD:289192 6/21 (29%)
Hoxb8NP_001178578.1 Homeobox 150..203 CDD:395001 42/52 (81%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.