DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and EN2

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001418.2 Gene:EN2 / 2020 HGNCID:3343 Length:333 Species:Homo sapiens


Alignment Length:317 Identity:77/317 - (24%)
Similarity:106/317 - (33%) Gaps:100/317 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 NDNSPGSASASASASAASSVAAAAAAAAAAASSSFAIPTSK----MYPYVSNHPSSH-------- 272
            ||..||.|:|:.........:....:.....||.....|.:    |.|.|...|.:|        
Human     4 NDPKPGEAAAAVEGQRQPESSPGGGSGGGGGSSPGEADTGRRRALMLPAVLQAPGNHQHPHRITN 68

  Fly   273 -----------------------------GGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPAS 308
                                         ||..|..|.:|.|....:..::.::         .|
Human    69 FFIDNILRPEFGRRKDAGTCCAGAGGGRGGGAGGEGGASGAEGGGGAGGSEQLL---------GS 124

  Fly   309 ASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACT--------------QPASGVMPGAGGAG 359
            .|.:..|....|..|...:.||.:.:.| |..|.:.|              .|..|.:...|..|
Human   125 GSREPRQNPPCAPGAGGPLPAAGSDSPG-DGEGGSKTLSLHGGAKKGGDPGGPLDGSLKARGLGG 188

  Fly   360 G------------AGIADLPRYPWMTLTDWMGSPFERVVCGDFNG-PNGCPR------------- 398
            |            || |:|...| |....|       |.|..::. |:..||             
Human   189 GDLSVSSDSDSSQAG-ANLGAQP-MLWPAW-------VYCTRYSDRPSSGPRSRKPKKKNPNKED 244

  Fly   399 RRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKK 455
            :|.|..:|..|...|:.||..|.|||.:||..:|..|.|.|.||||||||:|.|:||
Human   245 KRPRTAFTAEQLQRLKAEFQTNRYLTEQRRQSLAQELSLNESQIKIWFQNKRAKIKK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 26/51 (51%)
Abdominal-A 456..478 CDD:289192 77/317 (24%)
EN2NP_001418.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..49 9/44 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 95..206 25/121 (21%)
homeobox domain 243..302 29/59 (49%)
Homeobox 247..300 CDD:306543 26/52 (50%)
Engrail_1_C_sig 302..331 CDD:313702 77/317 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.