DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and ceh-54

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001338798.1 Gene:ceh-54 / 188474 WormBaseID:WBGene00020485 Length:221 Species:Caenorhabditis elegans


Alignment Length:99 Identity:32/99 - (32%)
Similarity:50/99 - (50%) Gaps:3/99 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   391 NGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKK 455
            |..|...::|.|.|:...|..|:||.|..|.|.....|.::|:.:.|.|.:::|||||||.|.::
 Worm    38 NNFNPDRKKRNRITFDANQIDEMEKVFAENQYPDTMSREKLANKIQLHEERVQIWFQNRRAKYRR 102

  Fly   456 ELRAVKEINEQ---ARRDREEQEKMKAQETMKSA 486
            |.:......|.   .:....|:||.:...|:.||
 Worm   103 EQKQTGHPYEPPSITKNPTGEKEKTQDCTTLTSA 136

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 21/51 (41%)
Abdominal-A 456..478 CDD:289192 5/24 (21%)
ceh-54NP_001338798.1 Homeobox 49..102 CDD:365835 21/52 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.