DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment abd-A and Pdx1

DIOPT Version :9

Sequence 1:	NP_732176.1	Gene:	abd-A / 42037	FlyBaseID:	FBgn0000014	Length:	590	Species:	Drosophila melanogaster
Sequence 2:	NP_032840.1	Gene:	Pdx1 / 18609	MGIID:	102851	Length:	284	Species:	Mus musculus

Alignment Length:	127	Identity:	57/127 - (44%)
Similarity:	64/127 - (50%)	Gaps:	22/127 - (17%)

- Green bases have known domain annotations that are detailed below.

  Fly   340 LGNACTQPASGVMPGA---GGAGGAGIADLPRYPWMTLT-------DWMGSPFERVVCGDFNGPN 394
            ||.|  .|..|..|..   ||........|| :|||..|       .|.|..:..       .|.
Mouse    91 LGLA--HPPPGPFPNGTEPGGLEEPNRVQLP-FPWMKSTKAHAWKGQWAGGAYTA-------EPE 145

  Fly   395 GCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKE 456
              ..:|.|..|||.|.|||||||.||.|::|.||:|:|..|.||||.|||||||||||.|||
Mouse   146 --ENKRTRTAYTRAQLLELEKEFLFNKYISRPRRVELAVMLNLTERHIKIWFQNRRMKWKKE 205

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
abd-A	NP_732176.1	Homeobox	402..454	CDD:278475	36/51 (71%)
abd-A	NP_732176.1	Abdominal-A	456..478	CDD:289192	1/1 (100%)
Pdx1	NP_032840.1	Transactivation domain. /evidence=ECO:0000250	13..73
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	30..116		8/26 (31%)
		Antp-type hexapeptide	119..124		3/5 (60%)
		Homeobox	150..203	CDD:278475	36/52 (69%)
		Nuclear localization signal	198..204		4/5 (80%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	202..284		3/4 (75%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0489
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810