powered by:
Protein Alignment abd-A and ceh-19
DIOPT Version :9
Sequence 1: | NP_732176.1 |
Gene: | abd-A / 42037 |
FlyBaseID: | FBgn0000014 |
Length: | 590 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001023142.1 |
Gene: | ceh-19 / 177590 |
WormBaseID: | WBGene00000442 |
Length: | 199 |
Species: | Caenorhabditis elegans |
Alignment Length: | 59 |
Identity: | 30/59 - (50%) |
Similarity: | 39/59 - (66%) |
Gaps: | 0/59 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 399 RRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKEL 457
|:.||.|:..|...||.||..:.||:..:||:::..|.|||.|||.||||||.|.||:|
Worm 95 RKPRQAYSARQLDRLETEFQTDKYLSVNKRIQLSQTLNLTETQIKTWFQNRRTKWKKQL 153
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0000007 |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.910 |
|
Return to query results.
Submit another query.