DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and nob-1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001369824.1 Gene:nob-1 / 176641 WormBaseID:WBGene00003779 Length:243 Species:Caenorhabditis elegans


Alignment Length:264 Identity:71/264 - (26%)
Similarity:102/264 - (38%) Gaps:68/264 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   213 SSLHRSLNDNSPGSASASASASAASSV----AAAAAAAAAAASSSFAIPTSKMYPYVSNHPSSHG 273
            |.:.:.:|::||..:..|.::...:..    ||||..:....|.|.....:...|.::  |||.|
 Worm     3 SVMQQMINNDSPEDSKESITSVQQTPFFWPSAAAAIPSIQGESRSERESETGSSPQLA--PSSTG 65

  Fly   274 ----GLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAASAVSAASAGA 334
                |.:||.||      ..||.  ...|.:..|..|.     :..|||:..|:.          
 Worm    66 MVMPGTAGMYGF------GPSRM--PTANEFGMMMNPV-----YTDFYQNPLAST---------- 107

  Fly   335 IGVDSLGNACTQPASGVMPGAGG---------AGGAGIADLP----RYPWMTLTDWMGSPFERVV 386
             |..|.|......|:..:|...|         ..|:..|..|    ..||....|          
 Worm   108 -GWYSYGQPYQFTANYSIPSLDGNLSDITIPTTAGSSAATTPNAAMHLPWAISHD---------- 161

  Fly   387 CGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRM 451
                       .::.||.|.:.|...||.|:..|.|||.:||.|::..|.|.|:|:|:|||||||
 Worm   162 -----------GKKKRQPYKKDQISRLEYEYSVNQYLTNKRRSELSAQLMLDEKQVKVWFQNRRM 215

  Fly   452 KLKK 455
            |.||
 Worm   216 KDKK 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 27/51 (53%)
Abdominal-A 456..478 CDD:289192 71/264 (27%)
nob-1NP_001369824.1 Homeobox 165..219 CDD:395001 27/53 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.