DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and egl-5

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001021166.1 Gene:egl-5 / 176093 WormBaseID:WBGene00001174 Length:223 Species:Caenorhabditis elegans


Alignment Length:281 Identity:70/281 - (24%)
Similarity:105/281 - (37%) Gaps:89/281 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   230 SASASAASSVAAAAAAAAAAASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFT---GLEDKSCSR 291
            :.|.||....::.|::||.:.:||              .|.::..||.:|..|   |.||...|.
 Worm     2 NTSTSAFDFGSSTASSAATSTTSS--------------QPDANDHLSRLAAMTQGVGKEDPETSS 52

  Fly   292 YTDTVMNSYQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAG 356
            ...|..:.|..:|.....|..:.|.|                        |...||         
 Worm    53 TPSTEASLYPGISAAYMQSYGWPQNY------------------------NYFGQP--------- 84

  Fly   357 GAGGAGIADLPRYP-------WMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELE 414
                .|.|..|.:|       |....:...|                 .::|||||.|:||..||
 Worm    85 ----LGPATFPGWPQCYPNTAWPNYGELFAS-----------------SKKGRQTYQRYQTSVLE 128

  Fly   415 KEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQA-----------R 468
            .:|..:.|:::::|.|:.....||:|||||||||||||.|||.:.|.:..|..           .
 Worm   129 AKFQQSSYVSKKQREELRLQTQLTDRQIKIWFQNRRMKAKKEKQRVDDHTEHTPLLPANPPKGMG 193

  Fly   469 RDREEQEKMKAQETMKSAQQN 489
            .|.::::|.:......:|..|
 Worm   194 MDMDDEKKWQMAHWPPAAAHN 214

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 28/51 (55%)
Abdominal-A 456..478 CDD:289192 5/32 (16%)
egl-5NP_001021166.1 Homeobox 116..168 CDD:278475 28/51 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.010

Return to query results.
Submit another query.