DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and mab-5

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_498695.1 Gene:mab-5 / 176091 WormBaseID:WBGene00003102 Length:200 Species:Caenorhabditis elegans


Alignment Length:257 Identity:83/257 - (32%)
Similarity:122/257 - (47%) Gaps:83/257 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   225 GSASASASASAASSVAAAAAAAAAAASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSC 289
            |:.::|.|||:.:|.:|:::||||||:::  :.|.::|    ||                     
 Worm    18 GTTASSQSASSGTSASASSSAAAAAAANN--LKTYELY----NH--------------------- 55

  Fly   290 SRYTDTVMNSYQSMSVPA---SASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGV 351
                 |.||:.:.|....   ::|..||.....||:|....:..|..||         :||.   
 Worm    56 -----TYMNNMKHMLAAGWMDNSSNPFAYNPLQATSANFGETRTSMPAI---------SQPV--- 103

  Fly   352 MPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKE 416
                             :|||.:                .|..|...:|.||||:|.||||||||
 Worm   104 -----------------FPWMKM----------------GGAKGGESKRTRQTYSRSQTLELEKE 135

  Fly   417 FHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELR---AVKEINEQARRDREEQE 475
            ||::.||||:||.||:..|.|||||:||||||||||.|||.:   ...|.:|::.:|.:.::
 Worm   136 FHYHKYLTRKRRQEISETLHLTERQVKIWFQNRRMKHKKEAKGEGGSNESDEESNQDEQNEQ 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 39/51 (76%)
Abdominal-A 456..478 CDD:289192 4/23 (17%)
mab-5NP_498695.1 Homeobox 120..173 CDD:278475 39/52 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 92 1.000 Domainoid score I4800
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.