DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and cog-1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001022264.1 Gene:cog-1 / 175149 WormBaseID:WBGene00000584 Length:256 Species:Caenorhabditis elegans


Alignment Length:251 Identity:64/251 - (25%)
Similarity:101/251 - (40%) Gaps:66/251 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   208 SASGSSSLHRSLNDNSPGSASASASASAASSVAAAAAAAAAAASSSFAIPTSKMYPYVSNHPSSH 272
            |.|||||...|.:.|.....|.||::|.....|::::::.:|.|     ||..|...::|..:..
 Worm    41 SPSGSSSEDDSASSNDDDQRSPSATSSFIFPPASSSSSSESATS-----PTQIMAQLMANGGAVD 100

  Fly   273 GGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIGV 337
            .||  .|.|..|:.:..|:   ::||.....:|                         |......
 Worm   101 PGL--QAYFFLLQSQLNSQ---SMMNRVTQENV-------------------------SRALTSF 135

  Fly   338 DSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPN--GCPRRR 400
            :.|.|         :|||          ||..          ||..|:.......||  ...:::
 Worm   136 NLLNN---------LPGA----------LPSL----------SPMGRLQHSMQLSPNSLNMQKKQ 171

  Fly   401 GRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKE 456
            .|.|:|..|..:||::|....||....|.::|..|.::|.|:|:||||||.|.:|:
 Worm   172 SRPTFTGHQIYQLERKFEQTKYLAGADRAQLAQELNMSESQVKVWFQNRRTKWRKK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 22/51 (43%)
Abdominal-A 456..478 CDD:289192 0/1 (0%)
cog-1NP_001022264.1 Homeobox 172..226 CDD:365835 22/53 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.