DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Meox1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_036012267.1 Gene:Meox1 / 17285 MGIID:103220 Length:271 Species:Mus musculus


Alignment Length:272 Identity:52/272 - (19%)
Similarity:80/272 - (29%) Gaps:98/272 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 LLTPPSAGNSQAGDSSCSPSPSASGSSSLHRSLNDNSPGSASASASASAASSVAAAAAAAAAAAS 251
            |..|.|..:|.:|.|...|:|.         |.:..|...|:|:....:||.:||          
Mouse    22 LRNPHSEDSSASGLSHYPPTPF---------SFHQKSDFPATAAYPDFSASCLAA---------- 67

  Fly   252 SSFAIPT-----SKMYPYVSNHPSSHGGLSGM----------------AGFTGLEDKSCSRYTD- 294
            :..::|.     ::.:|.....|..|..:|..                ||..||.|.:.....| 
Mouse    68 TPHSLPRTERIFNEQHPAFPQTPDWHFPISEAGQRLNLGPAGSAREMGAGSPGLVDGTAGLGEDC 132

  Fly   295 ----TVMNSYQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSL--GNACTQPASGVMP 353
                |:.|..:..|             .......|..|........|::.  |:||       :|
Mouse   133 MVLGTIANETEKKS-------------SRRKKERSGQSLVPEPEDEVETCEGGSAC-------VP 177

  Fly   354 GAGGAGGAGIADLPRY----------------------PWMTLTD-WM--GSPFERVVC------ 387
            ...|..|.|:....::                      |..||:. |.  |.|...:.|      
Mouse   178 TGAGPRGWGLCSFSKFRVRCSKDQNQERLKEPPLQFPPPGPTLSHLWTHPGQPAHTLRCEVAQYV 242

  Fly   388 GDFNGPNGCPRR 399
            |..|.|.|..:|
Mouse   243 GALNFPEGLAQR 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475
Abdominal-A 456..478 CDD:289192
Meox1XP_036012267.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.