DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and ceh-12

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_491693.1 Gene:ceh-12 / 172255 WormBaseID:WBGene00000436 Length:180 Species:Caenorhabditis elegans


Alignment Length:238 Identity:62/238 - (26%)
Similarity:85/238 - (35%) Gaps:103/238 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly   223 SPGSASASASASAAS---SVAAAAAAAAAAAS--SSFAIPTSKMYPYVSNHPSSHGGLSGMAGFT 282
            ||.|...:.|.|.:.   .:||.||..||.||  :||:..||         |:|           
 Worm    28 SPPSQIPNYSTSCSEELMKMAAKAAQFAAQASLENSFSSSTS---------PTS----------- 72

  Fly   283 GLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQP 347
                      |.|.:::|.|:..|.     ....|.| .|...:|:|..|               
 Worm    73 ----------TVTPLSAYTSLVQPV-----LPLIYDH-LALTYSVNAWQA--------------- 106

  Fly   348 ASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLE 412
                                   |..:                        ||.|..::..|.::
 Worm   107 -----------------------WGKM------------------------RRPRTAFSSEQLVQ 124

  Fly   413 LEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKK 455
            |||:|..|.||:|.||.::|..|.|:|.||||||||||||.|:
 Worm   125 LEKQFSDNRYLSRPRRYQLAQQLSLSETQIKIWFQNRRMKNKR 167

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 28/51 (55%)
Abdominal-A 456..478 CDD:289192 62/238 (26%)
ceh-12NP_491693.1 Homeobox 113..166 CDD:278475 28/52 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.