DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Lhx3

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_038962056.1 Gene:Lhx3 / 170671 RGDID:71078 Length:416 Species:Rattus norvegicus


Alignment Length:126 Identity:25/126 - (19%)
Similarity:42/126 - (33%) Gaps:39/126 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   443 KIWFQNRRMKLKKELRAVKEINEQARRDREEQEKMKAQETMKSAQQNKQVQQQQQQQQQQQQQQQ 507
            ::||||||.|.|:       :.:.|.|.|..|.....:.:..|::.:|...|:.|....:.....
  Rat   221 QVWFQNRRAKEKR-------LKKDAGRQRWGQYFRNMKRSRGSSKSDKDSIQEGQDSDAEVSFTD 278

  Fly   508 QQHQQQQQQPQDHHSIIAHNPGHLHHSVVGQNDLKLGLGMGVGVGVGGIGPGIG---GGLG 565
            :.....                             :|...|:...:|...|.:|   ||||
  Rat   279 EPSMAD-----------------------------MGTANGLYSSLGEPAPALGRPVGGLG 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 7/10 (70%)
Abdominal-A 456..478 CDD:289192 4/21 (19%)
Lhx3XP_038962056.1 LIM1_Lhx3b 18..72 CDD:188851
LIM2_Lhx3_Lhx4 80..135 CDD:188762
Homeobox 150..233 CDD:395001 7/11 (64%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.