DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Lbx2

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_034822.1 Gene:Lbx2 / 16815 MGIID:1342288 Length:195 Species:Mus musculus


Alignment Length:171 Identity:50/171 - (29%)
Similarity:65/171 - (38%) Gaps:48/171 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   305 VPASASAQFAQFYQHATAAASAVSA----ASAGAIGVDSLGNACTQPASG-VMPGAGGAGGAGIA 364
            ||.:.||  .|..:.....||.:.|    ||...:|...  .|..||:.| ..|.|....|||:.
Mouse    22 VPEAPSA--PQLPEAGPDPASPLCALEELASKTFLGHSP--RATPQPSEGRAAPEAPPGPGAGVR 82

  Fly   365 DLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRI 429
                                            .||:.|..:|..|.||||:.|.|..||....|.
Mouse    83 --------------------------------RRRKSRTAFTAQQVLELERRFVFQKYLAPSERD 115

  Fly   430 EIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRD 470
            .:|..|.|...|:..||||||.|||:::       |:.|.|
Mouse   116 GLAARLGLANAQVVTWFQNRRAKLKRDV-------EEMRAD 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 23/51 (45%)
Abdominal-A 456..478 CDD:289192 3/15 (20%)
Lbx2NP_034822.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..89 22/102 (22%)
Homeobox 87..140 CDD:278475 23/52 (44%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 164..195
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.