DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxd3

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_034598.2 Gene:Hoxd3 / 15434 MGIID:96207 Length:433 Species:Mus musculus


Alignment Length:254 Identity:74/254 - (29%)
Similarity:110/254 - (43%) Gaps:66/254 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   274 GLSGMAGFTGLEDKSCSRYTDTVMNS--YQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIG 336
            ||.|..|:        |:.|||...|  :|....||:|::..:.:...|.:..|:....:....|
Mouse    27 GLFGGYGY--------SKATDTYGYSTPHQPYPPPAAANSLDSDYPSSACSIQSSAPLRAPAHKG 83

  Fly   337 VDSLGNACTQPASGVMPGAGGAG------------------------------GAGI-------- 363
            .: |..:|.:|.:|...|.||..                              |:|:        
Mouse    84 AE-LNGSCMRPGTGNSQGGGGGNQPPGLNSEQQPPQPPPPPPPTLPPSSPTNPGSGVPAKKTKGG 147

  Fly   364 -------ADLPR--YPWMTLTDWMGSPFERVVCG------DFNGPNGCPRRRGRQTYTRFQTLEL 413
                   :.:.:  :|||  .:...:..::..|.      :...|.|...:|.|..||..|.:||
Mouse   148 LSASSSSSTISKQIFPWM--KESRQNSKQKNSCATSGENCEDKSPPGPASKRVRTAYTSAQLVEL 210

  Fly   414 EKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDRE 472
            |||||||.||.|.||:|:|:.|.||||||||||||||||.||:.:|...::..|.:..|
Mouse   211 EKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKYKKDQKAKGILHSPAGQSPE 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 37/51 (73%)
Abdominal-A 456..478 CDD:289192 3/17 (18%)
Hoxd3NP_034598.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 44..198 23/156 (15%)
Antp-type hexapeptide 161..166 3/6 (50%)
Homeobox 199..251 CDD:278475 37/51 (73%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 258..280 2/12 (17%)
DUF4074 370..431 CDD:290032
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 401..433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.