Sequence 1: | NP_732176.1 | Gene: | abd-A / 42037 | FlyBaseID: | FBgn0000014 | Length: | 590 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_034598.2 | Gene: | Hoxd3 / 15434 | MGIID: | 96207 | Length: | 433 | Species: | Mus musculus |
Alignment Length: | 254 | Identity: | 74/254 - (29%) |
---|---|---|---|
Similarity: | 110/254 - (43%) | Gaps: | 66/254 - (25%) |
- Green bases have known domain annotations that are detailed below.
Fly 274 GLSGMAGFTGLEDKSCSRYTDTVMNS--YQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIG 336
Fly 337 VDSLGNACTQPASGVMPGAGGAG------------------------------GAGI-------- 363
Fly 364 -------ADLPR--YPWMTLTDWMGSPFERVVCG------DFNGPNGCPRRRGRQTYTRFQTLEL 413
Fly 414 EKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDRE 472 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
abd-A | NP_732176.1 | Homeobox | 402..454 | CDD:278475 | 37/51 (73%) |
Abdominal-A | 456..478 | CDD:289192 | 3/17 (18%) | ||
Hoxd3 | NP_034598.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 44..198 | 23/156 (15%) | |
Antp-type hexapeptide | 161..166 | 3/6 (50%) | |||
Homeobox | 199..251 | CDD:278475 | 37/51 (73%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 258..280 | 2/12 (17%) | |||
DUF4074 | 370..431 | CDD:290032 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 401..433 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG0489 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |