DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxd1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_034597.2 Gene:Hoxd1 / 15429 MGIID:96201 Length:328 Species:Mus musculus


Alignment Length:286 Identity:78/286 - (27%)
Similarity:105/286 - (36%) Gaps:77/286 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   276 SGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQ-----FYQHATAAASAVSAASAGAI 335
            ||...|......:.:|.|.:.........||..|:.::|.     .|:...|.|   |||..|.:
Mouse    48 SGDGAFVSCLPLATARPTPSPPAGPAQSPVPQPAAPRYAPCTLEGAYERGAAPA---SAAEYGFL 109

  Fly   336 G-------VDSLGNACTQ-------PASGVMPGAGGAGGAGIADLPRY----PWMTL----TDWM 378
            |       ..:||.|..:       ..|.|..|.|....:|..|...:    |:...    .|..
Mouse   110 GSGPAFDFPGALGRAADEGGAHVHYATSAVFSGGGSFLLSGQVDFAAFGEPGPFPACLKEPADGH 174

  Fly   379 GSPFERVVCGDFNGPNGCPR--------------------RRG-------------------RQT 404
            ..||:.|    ...|..||:                    :|.                   |..
Mouse   175 PGPFQTV----SPAPGACPKPASPTSSLPAAHSTFEWMKVKRNAPKKSKLSEYGATSPPSAIRTN 235

  Fly   405 YTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKE----LRAVKEINE 465
            ::..|..|||||||||.||||.||||||:.|.|.:.|:||||||||||.||.    |.|......
Mouse   236 FSTKQLTELEKEFHFNKYLTRARRIEIANCLQLNDTQVKIWFQNRRMKQKKREREGLLATAASVA 300

  Fly   466 QARRDREEQEKMKAQETMKSAQQNKQ 491
            ..:..|.|...:|:...:.|..|.::
Mouse   301 SIKLPRSETSPIKSGRNLGSPSQAQE 326

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 34/51 (67%)
Abdominal-A 456..478 CDD:289192 4/25 (16%)
Hoxd1NP_034597.2 PRK04233 59..>105 CDD:305134 11/48 (23%)
Antp-type hexapeptide 204..209 0/4 (0%)
Homeobox 233..285 CDD:278475 34/51 (67%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 304..328 5/23 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.