DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxc9

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_032298.1 Gene:Hoxc9 / 15427 MGIID:96199 Length:260 Species:Mus musculus


Alignment Length:294 Identity:84/294 - (28%)
Similarity:114/294 - (38%) Gaps:107/294 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   224 PGSASASASASAASSV-------AAAAAAAAAAASSSFA-IPTSKMYPYVSNHPSSHGGLSGMAG 280
            |.:.:..|:|..:..|       :.:.|...|..|:|:| :|:.....|....|..|.|..    
Mouse    29 PATGAHPAAARPSGLVPDCSDFPSCSFAPKPAVFSTSWAPVPSQSSVVYHPYGPQPHLGAD---- 89

  Fly   281 FTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACT 345
                     :||..|.:.       |.|.:..|..|                             
Mouse    90 ---------TRYMRTWLE-------PLSGAVSFPSF----------------------------- 109

  Fly   346 QPASG----VMPGA--GGAGGAGIADLPRYPWMTLTDWM-GSPFE--------------RVVCG- 388
             ||.|    :.|.|  |.....|..|...||     |:| |||.|              ..:.| 
Mouse   110 -PAGGRHYALKPDAYPGRRADCGPGDGRSYP-----DYMYGSPGELRDRAPQTLPSPEADALAGS 168

  Fly   389 ---------DFNGP-----NGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTE 439
                     |.:.|     :....|:.|..||::|||||||||.||.||||.||.|:|..|.|||
Mouse   169 KHKEEKADLDPSNPVANWIHARSTRKKRCPYTKYQTLELEKEFLFNMYLTRDRRYEVARVLNLTE 233

  Fly   440 RQIKIWFQNRRMKLKKELRAVKEINEQARRDREE 473
            ||:||||||||||:||       :|:: :.|:|:
Mouse   234 RQVKIWFQNRRMKMKK-------MNKE-KTDKEQ 259

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 38/51 (75%)
Abdominal-A 456..478 CDD:289192 3/18 (17%)
Hoxc9NP_032298.1 Hox9_act 1..179 CDD:398350 38/204 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 120..182 15/66 (23%)
HOX 192..241 CDD:197696 32/48 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I4756
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.