DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxb7

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_034590.2 Gene:Hoxb7 / 15415 MGIID:96188 Length:217 Species:Mus musculus


Alignment Length:212 Identity:92/212 - (43%)
Similarity:108/212 - (50%) Gaps:41/212 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   285 EDKSCSRYTDTVMNSY-QSMSVPASASAQFAQFYQHATAAASAVSAASAG-AIGVDSLGNACT-- 345
            |..||:..::.....| .....|.|||.|.......|.|..||....:|| .:...|....|.  
Mouse    28 EQTSCAFASNPQRPGYGAGPGAPFSASVQGLYSGGGAMAGQSAAGVYAAGYGLEPSSFNMHCAPF 92

  Fly   346 -QPASGVMPG----AGGAGGAGIADLPR------YPWMTLTDWMGSPFERVVCGDFNGPNGCPRR 399
             |..|||.||    |.||.....:||..      ||||.                .:||:   |:
Mouse    93 EQNLSGVCPGDPAKAAGAKEQRDSDLAAESNFRIYPWMR----------------SSGPD---RK 138

  Fly   400 RGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEIN 464
            ||||||||:||||||||||:|.||||||||||||.||||||||||||||||||.|||       |
Mouse   139 RGRQTYTRYQTLELEKEFHYNRYLTRRRRIEIAHTLCLTERQIKIWFQNRRMKWKKE-------N 196

  Fly   465 EQARRDREEQEKMKAQE 481
            :.:......|:|.:|:|
Mouse   197 KTSGPGTTGQDKAEAEE 213

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 47/51 (92%)
Abdominal-A 456..478 CDD:289192 4/21 (19%)
Hoxb7NP_034590.2 Antp-type hexapeptide 126..131 3/4 (75%)
Homeobox 141..194 CDD:365835 47/52 (90%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 192..217 8/29 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.910

Return to query results.
Submit another query.