DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxb5

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_032294.2 Gene:Hoxb5 / 15413 MGIID:96186 Length:269 Species:Mus musculus


Alignment Length:271 Identity:99/271 - (36%)
Similarity:137/271 - (50%) Gaps:51/271 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   193 AGNSQAGDSSCSPSPSASGSSSLHRSLNDNSPGSASASASASAASSVAAAAAAAAA------AAS 251
            :|:|.:| |...|:...:||...:.:..|.|...:|||:|...|...::.|..|:|      .|:
Mouse    26 SGSSLSG-SYRDPAAMHTGSYGYNYNGMDLSVNRSSASSSHFGAVGESSRAFPASAQEPRFRQAT 89

  Fly   252 SSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQF 316
            ||.::.:.:..|..:.  .|||.           ..|.|..:|        .:.|||:||.|.:.
Mouse    90 SSCSLSSPESLPCTNG--DSHGA-----------KPSASSPSD--------QATPASSSANFTEI 133

  Fly   317 YQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPR-YPWMTLTDWMGS 380
            .:   |:||:....:|..:...||..|..:|.:.......|       ..|: :|||.       
Mouse   134 DE---ASASSEPEEAASQLSSPSLARAQPEPMATSTAAPEG-------QTPQIFPWMR------- 181

  Fly   381 PFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIW 445
              :..:..|..||:|   :|.|..|||:||||||||||||.||||||||||||||||:|||||||
Mouse   182 --KLHISHDMTGPDG---KRARTAYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLSERQIKIW 241

  Fly   446 FQNRRMKLKKE 456
            |||||||.||:
Mouse   242 FQNRRMKWKKD 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 46/51 (90%)
Abdominal-A 456..478 CDD:289192 0/1 (0%)
Hoxb5NP_032294.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 75..173 28/128 (22%)
Antp-type hexapeptide 176..181 2/4 (50%)
Homeobox 198..251 CDD:365835 46/52 (88%)
PRK07003 <67..>171 CDD:235906 28/127 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.