DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxb4

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_034589.3 Gene:Hoxb4 / 15412 MGIID:96185 Length:250 Species:Mus musculus


Alignment Length:250 Identity:80/250 - (32%)
Similarity:101/250 - (40%) Gaps:75/250 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   250 ASSSFAI---------PTSKMYPYVSNHPSSH------GGLSGMAGFTGLEDKSCSRYTDTVMNS 299
            |.|||.|         |..:.|......||.|      ||....:||.  .:.:..|.....:..
Mouse     2 AMSSFLINSNYVDPKFPPCEEYSQSDYLPSDHSPGYYAGGQRRESGFQ--PEAAFGRRAPCTVQR 64

  Fly   300 YQSMSVPA------------------------SASAQFAQFYQHATAAASA--VSAASAGAIGVD 338
            |.:...|.                        :|.|...:..|.:.|.:|:  ....:...:...
Mouse    65 YAACRDPGPPPPPPPPPPPPPPGLSPRAPVQPTAGALLPEPGQRSEAVSSSPPPPPCAQNPLHPS 129

  Fly   339 SLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPN--GCPRRRG 401
            ...:||.:|..                   ||||          .:|.....| ||  |...:|.
Mouse   130 PSHSACKEPVV-------------------YPWM----------RKVHVSTVN-PNYAGGEPKRS 164

  Fly   402 RQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKE 456
            |..|||.|.||||||||:|.|||||||:||||||||:||||||||||||||.||:
Mouse   165 RTAYTRQQVLELEKEFHYNRYLTRRRRVEIAHALCLSERQIKIWFQNRRMKWKKD 219

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 43/51 (84%)