DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxb3

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001073338.1 Gene:Hoxb3 / 15410 MGIID:96184 Length:433 Species:Mus musculus


Alignment Length:324 Identity:86/324 - (26%)
Similarity:112/324 - (34%) Gaps:109/324 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 QQQQHLHHQQQQHHHQYSSLSAALQLQQQQHHISKLAAAAVASHGHAHQQLLLTPPSAGNSQAGD 200
            |...||....|:......||..|     ..|..||....:....|.|.:. |..||.        
Mouse    38 QAATHLEGDYQRSACSLQSLGNA-----APHAKSKELNGSCMRPGLAPEP-LPAPPG-------- 88

  Fly   201 SSCSPSPSASGSSSLHRSLNDNSPGSASASASASAASSVAAAAAAAAAAASSSFAIPTSKMYPYV 265
               ||.|||:.:|:...|.|...|..:......:.::|..                 |.:::|::
Mouse    89 ---SPPPSAAPTSTTSNSNNGGGPSKSGPPKCGAGSNSTL-----------------TKQIFPWM 133

  Fly   266 SNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAASAVSAA 330
            ..                      ||.|..:.||                            |..
Mouse   134 KE----------------------SRQTSKLKNS----------------------------SPG 148

  Fly   331 SAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNG 395
            :|...|....|........|...|.||.||.|                         ||.:.|..
Mouse   149 TAEGCGGGGGGGGGGGGGGGGSSGGGGGGGGG-------------------------GDKSPPGS 188

  Fly   396 CPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRA 459
            ...:|.|..||..|.:|||||||||.||.|.||:|:|:.|.|:||||||||||||||.||:.:|
Mouse   189 AASKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLSERQIKIWFQNRRMKYKKDQKA 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 36/51 (71%)
Abdominal-A 456..478 CDD:289192 1/4 (25%)
Hoxb3NP_001073338.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 63..124 17/72 (24%)
Antp-type hexapeptide 129..134 1/4 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..195 20/111 (18%)
Homeobox 195..248 CDD:365835 36/52 (69%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 249..276 1/4 (25%)
DUF4074 369..431 CDD:372548
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 389..433
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.