DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxa9

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_001264167.1 Gene:Hoxa9 / 15405 MGIID:96180 Length:295 Species:Mus musculus


Alignment Length:132 Identity:56/132 - (42%)
Similarity:65/132 - (49%) Gaps:38/132 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   366 LPRYPW----MTLTDWMGSPFERVVCGDF------------------NGP-----NGCPRRRGRQ 403
            :||.||    .|..|....|.|    |.|                  |.|     :....|:.|.
Mouse   174 IPRRPWRRRRRTAVDREKQPSE----GAFSENNAENESGGDKPPIDPNNPAANWLHARSTRKKRC 234

  Fly   404 TYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQAR 468
            .||:.|||||||||.||.||||.||.|:|..|.|||||:||||||||||:||       ||:...
Mouse   235 PYTKHQTLELEKEFLFNMYLTRDRRYEVARLLNLTERQVKIWFQNRRMKMKK-------INKDRA 292

  Fly   469 RD 470
            :|
Mouse   293 KD 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 38/51 (75%)
Abdominal-A 456..478 CDD:289192 3/15 (20%)
Hoxa9NP_001264167.1 Hox9_act <190..216 CDD:282473 4/29 (14%)
Homeobox 232..285 CDD:278475 38/52 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 120 1.000 Inparanoid score I4756
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.