DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxa6

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_034584.1 Gene:Hoxa6 / 15403 MGIID:96178 Length:232 Species:Mus musculus


Alignment Length:269 Identity:94/269 - (34%)
Similarity:113/269 - (42%) Gaps:76/269 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   251 SSSFAIPTSKMYPYVSNHPSSHGGLSGM-----AGFTGLEDKSCSRYTDTVMNSYQSMSVPASAS 310
            ||.|..||     :..:.||......|.     ||:..|.....         ||.:.|:|....
Mouse     2 SSYFVNPT-----FPGSLPSGQDSFLGQLPLYPAGYDALRPFPA---------SYGASSLPDKTY 52

  Fly   311 AQFAQFYQHATAAASAVSAASAGAIGVDSLGNAC---TQPASGVMPGA----------------- 355
            .. ..|||.:.:..:...|:.       ..|.:|   .:..||..|..                 
Mouse    53 TS-PCFYQQSNSVLACNRASY-------EYGASCFYSDKDLSGASPSGNNKQRGPGDYLHFSPEQ 109

  Fly   356 -----GGAGGAGIAD--------LPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTR 407
                 |...|..:.:        .|.||||   ..|.|     ..|...|.:|   |||||||||
Mouse   110 QYKPDGSVQGKALHEEGTDRKYTSPVYPWM---QRMNS-----CAGAVYGSHG---RRGRQTYTR 163

  Fly   408 FQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDRE 472
            :||||||||||||.|||||||||||:|||||||||||||||||||.|||.:.:.......     
Mouse   164 YQTLELEKEFHFNRYLTRRRRIEIANALCLTERQIKIWFQNRRMKWKKENKLINSTQASG----- 223

  Fly   473 EQEKMKAQE 481
            |..:.||.|
Mouse   224 EDSEAKAGE 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 48/51 (94%)
Abdominal-A 456..478 CDD:289192 2/21 (10%)
Hoxa6NP_034584.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 88..126 3/37 (8%)
Antp-type hexapeptide 135..140 4/7 (57%)
Homeobox 158..210 CDD:278475 48/51 (94%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45659
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
65.870

Return to query results.
Submit another query.