DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hoxa4

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_032291.1 Gene:Hoxa4 / 15401 MGIID:96176 Length:285 Species:Mus musculus


Alignment Length:254 Identity:89/254 - (35%)
Similarity:108/254 - (42%) Gaps:68/254 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   252 SSFAIPTS----KMYPYVSNHPSSHGGLSGMAGFTG---------------LEDKSCSR-----Y 292
            |||.|.::    |..|:....|  |||..|..|..|               ..:...:|     |
Mouse     4 SSFLINSNYIEPKFPPFEEFAP--HGGPGGGDGAVGGGPGYPRPQSAPHLPAPNPHAARQPPAYY 66

  Fly   293 TDTVMN-SYQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQP-------AS 349
            ...... ||.....||.|:|     ..:|...||......:.|.|...  :...||       |.
Mouse    67 APRAREPSYPGGLYPAPAAA-----CPYACRGASPARPEQSPAPGAHP--SPAPQPPAPPRHCAP 124

  Fly   350 GVMPGAGGAGGAG------IADL----PR------YPWMTLTDWMGSPFERVVCGDFNGP-NGCP 397
            |....|...||:.      :||.    |:      ||||          :::.....|.. ||..
Mouse   125 GPTTPAVATGGSAPACPLLLADQGPAGPKGKEPVVYPWM----------KKIHVSAVNSSYNGGE 179

  Fly   398 RRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKE 456
            .:|.|..|||.|.||||||||||.||||||||||||.|||:|||:||||||||||.||:
Mouse   180 PKRSRTAYTRQQVLELEKEFHFNRYLTRRRRIEIAHTLCLSERQVKIWFQNRRMKWKKD 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 43/51 (84%)
Abdominal-A 456..478 CDD:289192 0/1 (0%)
Hoxa4NP_032291.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 19..70 10/52 (19%)
Antp-type hexapeptide 159..164 4/14 (29%)
Homeobox 183..236 CDD:278475 43/52 (83%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 238..285 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.810

Return to query results.
Submit another query.