DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment abd-A and Hoxa3

DIOPT Version :9

Sequence 1:	NP_732176.1	Gene:	abd-A / 42037	FlyBaseID:	FBgn0000014	Length:	590	Species:	Drosophila melanogaster
Sequence 2:	NP_034582.1	Gene:	Hoxa3 / 15400	MGIID:	96175	Length:	443	Species:	Mus musculus

Alignment Length:	133	Identity:	57/133 - (42%)
Similarity:	65/133 - (48%)	Gaps:	19/133 - (14%)

- Green bases have known domain annotations that are detailed below.

  Fly   343 ACTQPASGVMPGAGGAGG---AGIADLPR----------YPWM------TLTDWMGSPFERVVCG 388
            |...|.|.|.|.......   |..|..|.          :|||      |.....||.......|
Mouse   118 AAPPPPSSVSPPQSANSNPTPASTAKSPLLNSPTVGKQIFPWMKESRQNTKQKTSGSSSGESCAG 182

  Fly   389 DFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKL 453
            |.:.|.....:|.|..||..|.:|||||||||.||.|.||:|:|:.|.||||||||||||||||.
Mouse   183 DKSPPGQASSKRARTAYTSAQLVELEKEFHFNRYLCRPRRVEMANLLNLTERQIKIWFQNRRMKY 247

  Fly   454 KKE 456
            ||:
Mouse   248 KKD 250

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
abd-A	NP_732176.1	Homeobox	402..454	CDD:278475	37/51 (73%)
abd-A	NP_732176.1	Abdominal-A	456..478	CDD:289192	0/1 (0%)
Hoxa3	NP_034582.1	Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	74..151		8/32 (25%)
		Antp-type hexapeptide	156..161		2/4 (50%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	163..197		7/33 (21%)
		COG5576	<182..309	CDD:227863	43/69 (62%)
		Homeobox	196..249	CDD:365835	37/52 (71%)
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	248..354		2/3 (67%)
		DUF4074	378..441	CDD:372548
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	401..443
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG0489
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	2	1.810