DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Hmx1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_034575.1 Gene:Hmx1 / 15371 MGIID:107178 Length:332 Species:Mus musculus


Alignment Length:311 Identity:72/311 - (23%)
Similarity:94/311 - (30%) Gaps:86/311 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   172 AAAAVASHGHAHQQLLLTPPSAGNSQAGD------SSCSPSPSASGSSSLHRSLNDNSPGSASAS 230
            |..|.||.......|......||.|..||      ......|.........|.|.......|.:.
Mouse    11 ATPARASSFLIENLLAAEAKGAGRSTQGDGVREEEEEDDDDPEDEDPEQARRRLQRRRQQRAGSG 75

  Fly   231 ASASAASSVAAAAAAAAAAASSSFAI---PTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSR- 291
            ....|.:................||:   .|::.||.|      |||..|     ||...:..| 
Mouse    76 PGGEARARALGLGPRPPPGPGPPFALGCGGTTRWYPRV------HGGYGG-----GLSPDTSDRD 129

  Fly   292 --YTDTVMNSYQSM--------SVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQ 346
              .|...|...:|.        :||...:.|     ..||....|...|.|.|:...:.|.|   
Mouse   130 SPETGEEMGRAESAWPRCPGPGTVPREVTTQ-----GPATGGEEAAELAEAPAVAAAATGEA--- 186

  Fly   347 PASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTL 411
                                                           .|..|::.|..::|.|..
Mouse   187 -----------------------------------------------RGGRRKKTRTVFSRSQVF 204

  Fly   412 ELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKE 462
            :||..|....||:...|..:|.:|.|||.|:||||||||.|.|::|.|..|
Mouse   205 QLESTFDLKRYLSSAERAGLAASLQLTETQVKIWFQNRRNKWKRQLAAELE 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 24/51 (47%)
Abdominal-A 456..478 CDD:289192 3/7 (43%)
Hmx1NP_034575.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 28..170 31/157 (20%)
Homeobox 194..247 CDD:278475 24/52 (46%)
HMX family specific domain 1 251..261 2/5 (40%)
HMX family specific domain 2 264..277
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.