DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Mnx1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_064328.2 Gene:Mnx1 / 15285 MGIID:109160 Length:404 Species:Mus musculus


Alignment Length:327 Identity:98/327 - (29%)
Similarity:126/327 - (38%) Gaps:107/327 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 GNSQAGDSSCSP----------------SPSASGSSSLHRSLNDNSPGSASASASASAA------ 236
            |.|.....||||                |||.....:.|.:|.. .||...|.....||      
Mouse    50 GTSSGASRSCSPASSEATAAPGDRLRAESPSPPRLLAAHCALLP-KPGFLGAGGGGGAAGGPGTP 113

  Fly   237 ------SSVAAAAAAAAAAASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDT 295
                  .:.|||||||||||:...|:         ..||   ||..|.||               
Mouse   114 HHHAHPGAAAAAAAAAAAAAAGGLAL---------GLHP---GGAQGGAG--------------- 151

  Fly   296 VMNSYQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIGV---DSLGNACTQPASGVMPGAG- 356
                     :||.|:......|.::.|||:|..|....|:..   ...|.....||..:..||. 
Mouse   152 ---------LPAQAALYGHPVYSYSAAAAAAALAGQHPALSYSYPQVQGAHPAHPADPIKLGAST 207

  Fly   357 -------GAGGAGIADLPRYPWMTLTDWMGSPFERVVCGDFNGP------NGCPRRRGRQTYTRF 408
                   .|..||:. ||:.|                  ||:..      ..|  ||.|..:|..
Mouse   208 FQLDQWLRASTAGMI-LPKMP------------------DFSSQAQSNLLGKC--RRPRTAFTSQ 251

  Fly   409 QTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREE 473
            |.||||.:|..|.||:|.:|.|:|.:|.|||.|:||||||||||.|:.    |:..|||.::.|:
Mouse   252 QLLELEHQFKLNKYLSRPKRFEVATSLMLTETQVKIWFQNRRMKWKRS----KKAKEQAAQEAEK 312

  Fly   474 QE 475
            |:
Mouse   313 QK 314

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 30/51 (59%)
Abdominal-A 456..478 CDD:289192 6/20 (30%)
Mnx1NP_064328.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..80 7/29 (24%)
Homeobox 244..297 CDD:278475 30/52 (58%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 299..404 6/20 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000007
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.