DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Gsc

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_034481.1 Gene:Gsc / 14836 MGIID:95841 Length:256 Species:Mus musculus


Alignment Length:272 Identity:71/272 - (26%)
Similarity:99/272 - (36%) Gaps:63/272 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   235 AASSVAAAAAA--------------AAAAASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLE 285
            |...||.:|||              |....||.:    ...||    .|.:.||    ||.....
Mouse    21 AVLPVAPSAAAPVVFPALHGDSLYGAGGGTSSDY----GAFYP----RPVAPGG----AGLPAAV 73

  Fly   286 DKSCSRYTDTVMNSYQSMSVPASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASG 350
            ..|...|     |||               ||......|:.|..|..||  |..||   .|..|.
Mouse    74 GSSRLGY-----NSY---------------FYGQLHVQAAPVGPACCGA--VPPLG---AQQCSC 113

  Fly   351 V--MPGAGGAGGAGIADLPR--YPWMTLTDWMGSPFERVVCGDFNGPNGCPRRRGRQTYTRFQTL 411
            |  .||..|.|...::.:|.  .|:|.:     ....|......|..:...:||.|..:|..|..
Mouse   114 VPTPPGYEGPGSVLVSPVPHQMLPYMNV-----GTLSRTELQLLNQLHCRRKRRHRTIFTDEQLE 173

  Fly   412 ELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEK 476
            .||..|....|.....|.::|..:.|.|.::::||:|||.|.:::.|:..|.:|.|.:..:...|
Mouse   174 ALENLFQETKYPDVGTREQLARKVHLREEKVEVWFKNRRAKWRRQKRSSSEESENAEKWNKTSSK 238

  Fly   477 M---KAQETMKS 485
            .   |.:|..||
Mouse   239 ASPEKREEEGKS 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 17/51 (33%)
Abdominal-A 456..478 CDD:289192 5/24 (21%)
GscNP_034481.1 Homeobox 163..216 CDD:278475 17/52 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..256 10/38 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.