DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and gbx1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_777286.1 Gene:gbx1 / 142985 ZFINID:ZDB-GENE-020117-2 Length:316 Species:Danio rerio


Alignment Length:271 Identity:78/271 - (28%)
Similarity:97/271 - (35%) Gaps:79/271 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   216 HRSLNDNSPGSASASASASAASSVAAA-------AAAAAAAASSSFAIPTSKMYPYVSNHPSSHG 273
            |.||....|..|..::.|...::...|       :..|......||:.|....|| ....|....
Zfish    49 HSSLPSGIPPLAPLASFAGRLTNTFCAGLGQGMPSMVALTTTLPSFSDPPDSFYP-PQEMPGPRL 112

  Fly   274 GLSGMAGFTGLEDKSCSRYTDTVMNSYQSM--SVPASASAQFAQFYQ------------------ 318
            |..|                 |.||..:|.  .:..|....|.:.:|                  
Zfish   113 GADG-----------------TGMNRQESPHDELKGSELLNFTETFQAVAGETKLYSSDDEKLDL 160

  Fly   319 -HATAAASAVSAASAGAIGVD-SLGNACTQPASGVMPG--AGGAGGAGIADLPRYPWMTLTDWMG 379
             .|.||.|....:||.:.... |.||.|   ||....|  .||:..|    ||.           
Zfish   161 KAAEAACSDREDSSADSENESFSDGNTC---ASASQKGKLKGGSQDA----LPP----------- 207

  Fly   380 SPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKI 444
                       .|..|..||| |..:|..|.||||||||...||:...|.:|||||.|:|.|:||
Zfish   208 -----------GGSAGKSRRR-RTAFTSEQLLELEKEFHCKKYLSLTERSQIAHALKLSEVQVKI 260

  Fly   445 WFQNRRMKLKK 455
            ||||||.|.|:
Zfish   261 WFQNRRAKWKR 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 31/51 (61%)
Abdominal-A 456..478 CDD:289192 78/271 (29%)
gbx1NP_777286.1 Homeobox 217..270 CDD:278475 32/53 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG0489
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.