DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and Emx1

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:NP_034261.1 Gene:Emx1 / 13796 MGIID:95387 Length:257 Species:Mus musculus


Alignment Length:312 Identity:73/312 - (23%)
Similarity:111/312 - (35%) Gaps:96/312 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   177 ASHGHAHQQLLLTPPSAGNSQ-AGDSSCSPSPSASGSSSLH-RSLNDNSPGSASASASASAASSV 239
            |..|...:.|:......|.|. :|.:...|...|:....|. .:||...|       ||:..:.|
Mouse     6 AKRGFTIESLVAKDGGTGGSPGSGGAGSHPLAVAASEEPLRPTALNYPHP-------SAAETAFV 63

  Fly   240 AAAAAAAAAAASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMS 304
            :...|||||.|..|.......::|...|||:.                       ||..::|   
Mouse    64 SGFPAAAAAGAGRSLYGGPELVFPEAMNHPAL-----------------------TVHPAHQ--- 102

  Fly   305 VPASASAQFAQFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIAD-LPR 368
                                               ||::..||.....       .|...| |..
Mouse   103 -----------------------------------LGSSSLQPPHSFF-------SAQHRDPLHF 125

  Fly   369 YPWMTLTDWMGSPFERVVCGD-------FNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRR 426
            |||:....:.|..|:   ..|       .:||.....:|.|..::..|.|.||:.|..|||:...
Mouse   126 YPWVLRNRFFGHRFQ---ASDVPQDGLLLHGPFARKPKRIRTAFSPSQLLRLERAFEKNHYVVGA 187

  Fly   427 RRIEIAHALCLTERQIKIWFQNRRMKLKKELRAVKEINEQARRDREEQEKMK 478
            .|.::|.:|.|:|.|:|:||||||.|.|::     ::.|:.   .|.::|.|
Mouse   188 ERKQLAGSLSLSETQVKVWFQNRRTKYKRQ-----KLEEEG---PESEQKKK 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 23/51 (45%)
Abdominal-A 456..478 CDD:289192 3/21 (14%)
Emx1NP_034261.1 COG5576 108..>218 CDD:227863 38/124 (31%)
Homeobox 163..215 CDD:278475 23/51 (45%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 216..257 4/24 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.