DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and AgaP_AGAP001389

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_321747.5 Gene:AgaP_AGAP001389 / 1281788 VectorBaseID:AGAP001389 Length:331 Species:Anopheles gambiae


Alignment Length:336 Identity:75/336 - (22%)
Similarity:107/336 - (31%) Gaps:121/336 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 HHPQVQQQHLNHQQQQHLHHQQQQHHHQYSSLSAALQLQQQQ----HHISKLAAAAVASHGHAHQ 184
            |..:|:||:|.:|     ||    |.::.:..|.|..|..:.    |......::|:.|||    
Mosquito    19 HQQRVEQQNLLYQ-----HH----HANRLAGTSTANSLSSEPGSLIHSAPSSYSSALQSHG---- 70

  Fly   185 QLLLTPPSAGNSQAGDSSCSPSPSASGSSSLHRSLNDNSPGSASASASASAASSVAAAAAAAAAA 249
               :....||.:..| |....||.|.||.|        :.||...|..:.:.....|........
Mosquito    71 ---IPTDCAGGTPPG-SPVLASPLAIGSGS--------TGGSGGGSVRSESPKKPTAMYPGLLDF 123

  Fly   250 ASSSFAIPTSKMYPYVSNHPSSHGGLSGMAGFTGLEDKSCSRYTDTVMNSYQSMSVPASASAQFA 314
            :.:...||..                .||..|..|.......|.          ||...||.:..
Mosquito   124 SKNVIPIPLQ----------------FGMPAFNPLNAAYLEHYA----------SVLHKASPRVW 162

  Fly   315 QFYQHATAAASAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMG 379
            .||.|                           |.|.::|                          
Mosquito   163 PFYPH---------------------------PYSYLLP-------------------------- 174

  Fly   380 SPFERVVCGDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKI 444
                  .||.       .|:.|:..:|..||..|||.|..:.||:...|..:|..|.|::||:|.
Mosquito   175 ------TCGS-------KRKGGQVRFTPQQTQSLEKRFSNHKYLSPEDRRNLAIQLKLSDRQVKT 226

  Fly   445 WFQNRRMKLKK 455
            ||||||.|.::
Mosquito   227 WFQNRRAKWRR 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 23/51 (45%)
Abdominal-A 456..478 CDD:289192 75/336 (22%)
AgaP_AGAP001389XP_321747.5 Homeobox 186..236 CDD:278475 23/49 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.