DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and AgaP_AGAP009088

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_319836.3 Gene:AgaP_AGAP009088 / 1280042 VectorBaseID:AGAP009088 Length:389 Species:Anopheles gambiae


Alignment Length:96 Identity:26/96 - (27%)
Similarity:45/96 - (46%) Gaps:14/96 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   388 GDFNGPNGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMK 452
            |..:|.:.  .:|.|.|.|..|...|:..::.:....|..|.:::....|..|.:::||||||.|
Mosquito   168 GSLDGESS--NKRPRTTITAKQLETLKSAYNSSPKPARHVREQLSQDTGLDMRVVQVWFQNRRAK 230

  Fly   453 ---LKKE---------LRAVKEINEQARRDR 471
               |||:         .|::|..:..:|.|:
Mosquito   231 EKRLKKDAGRTRWSQYFRSMKGTSSPSRVDK 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 16/54 (30%)
Abdominal-A 456..478 CDD:289192 4/25 (16%)
AgaP_AGAP009088XP_319836.3 LIM1_Lhx3_Lhx4 41..92 CDD:188754
LIM2_Lhx3_Lhx4 100..155 CDD:188762
Homeobox 179..232 CDD:278475 16/52 (31%)
Forkhead_N 284..373 CDD:254796
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.