DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and AgaP_AGAP005099

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_313975.4 Gene:AgaP_AGAP005099 / 1274774 VectorBaseID:AGAP005099 Length:276 Species:Anopheles gambiae


Alignment Length:217 Identity:64/217 - (29%)
Similarity:78/217 - (35%) Gaps:67/217 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   394 NGCPRRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMKLKKELR 458
            :|..::|.|..:|..|..|||:.|...||.....|.|||..:.|||.::::||||||.|.||..:
Mosquito    17 HGAKQKRHRTRFTPAQLNELERCFSKTHYPDIFMREEIAMRIGLTESRVQVWFQNRRAKWKKRKK 81

  Fly   459 AVK-------------------EINEQARR-----------DR--EEQEKMKAQETM-------- 483
            ...                   .|...|..           ||  .....|.|.:||        
Mosquito    82 TTNVFRTPGALLPSHGLPPFGANITNIAMSESLCGTSMFGGDRWGVGVNPMTAGDTMMYQHSVGG 146

  Fly   484 --------------------------KSAQQNKQVQQQQQQQQQQQQQQQQQHQQQQQQPQDHHS 522
                                      .|.||..|.||||..||||||||||| ||||...|:..|
Mosquito   147 VGCTGGSPTSTPPNINACSPSTPPLTNSGQQPNQPQQQQPHQQQQQQQQQQQ-QQQQGASQNDAS 210

  Fly   523 IIAHNPGHLHHSVVGQNDLKLG 544
            ......|...|.:.....|..|
Mosquito   211 ANGEMSGPNQHGIGNCQSLSAG 232

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 23/51 (45%)
Abdominal-A 456..478 CDD:289192 4/53 (8%)
AgaP_AGAP005099XP_313975.4 Homeobox 24..72 CDD:278475 19/47 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.