DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and AgaP_AGAP003674

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_313455.4 Gene:AgaP_AGAP003674 / 1274348 VectorBaseID:AGAP003674 Length:314 Species:Anopheles gambiae


Alignment Length:275 Identity:71/275 - (25%)
Similarity:107/275 - (38%) Gaps:41/275 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   200 DSSCSPSPSASGSSSLHRSLNDNSPGSASASASASAASSVAAAAAAAAAAASSSFAIPTSKMYPY 264
            ||.|....|.:..|   ..::.:..|:.|....:..||.....:..           ||::. |.
Mosquito    21 DSDCQSRVSYNSGS---EDIDLDGDGNGSCYEESDIASDHQTHSTE-----------PTTRS-PN 70

  Fly   265 VSNHPSSHGGLSGMAGFTGLEDKSCSRYTDT-----VMNSYQSMSVPASASAQFAQFYQHATAAA 324
             .|.|.|...|.|.:.....:||.... .||     :.|.:. ::|.:.:|.|:|     |.|..
Mosquito    71 -ENLPFSISRLLGKSYDRDQKDKDAGS-EDTGPEGLIKNGHH-ITVSSPSSLQYA-----AGALY 127

  Fly   325 SAVSAASAGAIGVDSLGNACTQPASGVMPGAGGAGGAGIADLPRYPWMTLTDWMGSPFERVVCGD 389
            |.........:.|......| .|.|..:|....|..|..|...|.....:...:|.|::      
Mosquito   128 SYPMYPGGHVLRVPPQRGPC-NPLSWTLPPLHPAALAHQAVKDRLAAFPIARRIGHPYQ------ 185

  Fly   390 FNGPNGCP--RRRGRQTYTRFQTLELEKEFHFNHYLTRRRRIEIAHALCLTERQIKIWFQNRRMK 452
                |..|  |::.|.::||.|..||||.||...||....|..:|..|.:|:.|:|.||||||.|
Mosquito   186 ----NRTPPKRKKPRTSFTRIQVAELEKRFHKQKYLASAERAALARGLKMTDAQVKTWFQNRRTK 246

  Fly   453 LKKELRAVKEINEQA 467
            .:::....:|...||
Mosquito   247 WRRQTAEEREAERQA 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475 25/51 (49%)
Abdominal-A 456..478 CDD:289192 3/12 (25%)
AgaP_AGAP003674XP_313455.4 COG5576 143..270 CDD:227863 41/130 (32%)
Homeobox 195..248 CDD:278475 25/52 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.