DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and AgaP_AGAP000063

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_566364.4 Gene:AgaP_AGAP000063 / 1272212 VectorBaseID:AGAP000063 Length:564 Species:Anopheles gambiae


Alignment Length:262 Identity:71/262 - (27%)
Similarity:102/262 - (38%) Gaps:80/262 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 SSSAAVAAALAAAAASASASVSASSSSNNNSSNTIAGSNTSNTNNSSSSPSSSSNNNSNLNLSGG 96
            |||||.|||.|||||:|.|..:||.||   .|..:.....|:..:|:.....|   |||......
Mosquito   356 SSSAAAAAAAAAAAAAAVAVQNASISS---CSLNLTAPLVSHVYDSNMCVEDS---NSNYLSKTY 414

  Fly    97 SLSPSHLSQHLGQSPHSPVSSSSPFQQHHPQVQQQHLNHQQQQHLHHQQQQHHHQYSSLSAALQL 161
            .|.||..:....:||.:|         :||...||                              
Mosquito   415 PLEPSFQNLDALKSPSAP---------NHPAAPQQ------------------------------ 440

  Fly   162 QQQQHHISKLAAAAVASHGHAHQQLLLTPPSAG---NSQAGDSSCSPSPSASGSSSLHRSLNDNS 223
                  :|..|.:...|..:|:       |:.|   |:..|......:|..|.::.:..||..|:
Mosquito   441 ------LSPAAMSFKLSFPNAN-------PNGGVGPNNGGGGGGGGAAPDGSAANLMGPSLGTNA 492

  Fly   224 PGSASASAS----------ASAASSV--AAAAAAAAAAASSSFAIPTSKMY--PYVSNHPSSHGG 274
             |...||.|          .|||:::  :|.:||||||...|:    :.||  ..:.|.|::.|.
Mosquito   493 -GFPHASTSDDKSLYNHFAYSAAANMHHSAYSAAAAAAVDQSY----NGMYLKNQLYNLPANAGV 552

  Fly   275 LS 276
            ||
Mosquito   553 LS 554

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475
Abdominal-A 456..478 CDD:289192
AgaP_AGAP000063XP_566364.4 PAX 7..131 CDD:128645
Homeobox 285..342 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.