DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment abd-A and AgaP_AGAP000067

DIOPT Version :9

Sequence 1:NP_732176.1 Gene:abd-A / 42037 FlyBaseID:FBgn0000014 Length:590 Species:Drosophila melanogaster
Sequence 2:XP_311087.5 Gene:AgaP_AGAP000067 / 1272206 VectorBaseID:AGAP000067 Length:313 Species:Anopheles gambiae


Alignment Length:212 Identity:38/212 - (17%)
Similarity:75/212 - (35%) Gaps:53/212 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PNSSSAAVAAALAAAAASASA--------SVSASSSSNNNSSNTIAGSNTSNTNNSSSSPSSSS- 85
            |..::|||.:.:|...|...:        .:.:..:.||::..:::..|....|.:|:..:||. 
Mosquito    92 PRVATAAVVSKIAEYKAECPSIFAWEIRDRLLSEGTCNNDNIPSVSSINRVLRNLASNKETSSQS 156

  Fly    86 -----------NNNSN-----LNLSGGSLS-PSHLSQHLG-----QSPHSPVS-----SSSPFQQ 123
                       ||.|.     .|:..|..: .||...||.     :.|..|.:     .|..:..
Mosquito   157 NETVYEKIKLFNNTSGHWTWCQNIGSGQFNFSSHPIPHLSLKTSTEQPTKPANCCLEEMSDKYSS 221

  Fly   124 HHPQVQQQHL-------------NHQQQQHLHHQQQQHHH----QYSSLSAALQLQQQQHHISKL 171
            ...:..:..|             .::|.::|..:.::.|:    ....||..:||.:.:..:..|
Mosquito   222 EDDEDSELRLKLKRKLQRNRTSFTNEQIENLEREFERTHYPDVFARERLSERIQLPEARIQVMLL 286

  Fly   172 AAAAVASHGHAHQQLLL 188
            ..||....|:.....:|
Mosquito   287 CPAARWLRGNRGNMAIL 303

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
abd-ANP_732176.1 Homeobox 402..454 CDD:278475
Abdominal-A 456..478 CDD:289192
AgaP_AGAP000067XP_311087.5 PAX 20..144 CDD:128645 9/51 (18%)
Homeobox 241..>283 CDD:278475 7/41 (17%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.